Scaffold Ga0307402_10034971

Overview

Basic Information

• Taxon OID: 3300030653
• Scaffold ID: Ga0307402_10034971
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2101
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -70.3658
  • Long. (^o): -8.2821
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037016	Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307402_100349712	F037016	N/A	VLSRGRAFLISCCATRFLRFSACSMIYGIVLYVGAIVVSAVDPRDLQRARAKVPRKEWKGTNPSGMGDTLNGHLLKMFPNTKPCHEWSAEELQNYQAQLYDFKYEDFDKIYATTYDNRRMRLDSLDSHEKHWNKVNALVSQHGHLKEMHRDGHCHEAVMWLVHHVPAADQQTVFAKVAAPLLPSKRHSCGPNVTEAESEICKVYEGMYSCADCHSNSGIIAQDYSDLDGKIPEDPAHPGWAIQRRCDQNYMPACGPCDGIGGPYWGDSVKKFQPTSCEVVALPEAVPVAERQTPEFAEQFIVHQLGSDRLARTQNAARFAIYSQVRSTLWYDFPLGGQSNGTATDGMAKLRHDTYYDDLGYKWLDNGLVSEVHLQSREQRENNITGPMVSLIHGLLGYGKYLGGLTCLADPVGVPVLAGKVNVKNLAHSSFTMGADYKGRIKIGVEYDGFKLGDKGNGDMTKKRIMTVDHYVKWFLHLFVDADKASPTFGQPVRFYGPYSGFAVYISFNKTVPPPEVYETACVGALNGWPTSEKKPLHPCEGKKITDFPCMVVEKNHPEVCKPWASSSSGDLQEAPLEFERFSGAFGSVHIPKQSQQPTY