NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311354_10369101

Scaffold Ga0311354_10369101


Overview

Basic Information
Taxon OID3300030618 Open in IMG/M
Scaffold IDGa0311354_10369101 Open in IMG/M
Source Dataset NameII_Palsa_E3 coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1459
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061166Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0311354_103691011F061166GAGGMRTTARFFGLLASFLFCVSAIFAQTNPPPPDPHEMVTRQPRTLSKPADRSAAIDLLDRARKNYDLHGISTPYALKVSFETNGAAQTEGAGTIEDLSDGGSHWRWTAQLQDAHLIRIGSDGHVYGTDPSEPVPLRVQMVRSALYWPIVHNVGAHVIRAANVDRDGKAISCLLLSHSLPPNPAPRSWVENEYCVDSATGLLQMWSEAPGIYVVYDYTGAAEFHGHTLPRQVSVFEDGRLAVQAHVESLEDAPSIDPNLFK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.