Scaffold Ga0257185_10170290

Overview

Basic Information

• Taxon OID: 3300030615
• Scaffold ID: Ga0257185_10170290
• Source Dataset Name: Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 695
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.7544
  • Long. (^o): -113.9092

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011159	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257185_101702901	F011159	N/A	LPRDSGFIYTFFINPNPIIMVTNPIIYTILFSMGFLLLIHSIQSAPMHNDESLMYRTFDEDQEDTSSSFDKRTFSNSDIPDGYVGIMLGKRRVESRGVRLPTEAILLGKRRLPYEAVLLGKRDLPNEAILLGKRRIPHEAVLLGRRDLPNEAILLGKRDLPNEAVLLGKRDLPNEAVLLGKRDLPNEGILLGK