Scaffold Ga0257196_1390641

Overview

Basic Information

• Taxon OID: 3300030612
• Scaffold ID: Ga0257196_1390641
• Source Dataset Name: Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 46.9233
  • Long. (^o): -110.8694

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098513	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257196_13906411	F098513	N/A	CDGDFCNTDTEAPCPPPPKVTPKNEVKACYQCKGVDACRPDRLDAAGVRTSAMFGAKNLYCYTKFDQKTGAVIARGGFGFGDVFDKYLSCDAKHYLCCYENLCNNHTVGFCAKRQHH