Scaffold Ga0210261_1011053

Overview

Basic Information

• Taxon OID: 3300030582
• Scaffold ID: Ga0210261_1011053
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1119
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 47.2713
  • Long. (^o): -71.2091

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046118	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210261_10110531	F046118	N/A	PQSYTCDPCSGATAISCNTGTGPGSSPSPLNGYQCAGSGSQSYSGNFYRVYVLNNIQATLPFSTATINSFSVQVLDRQTNPGPNVSSYSFIVTRAPPPIVGDPQIIGMQGQDFQVHGIPDEIFNMITYPNLQVNARFAYLSSAECIDNYTACFAHPGTYISEEGIRLGSDKIHVRAGSAKKGLTVSVNGQKLASGAQDVKLGSVELLNHRRVVIKTPIMGITITNSDKFLNQETSLYDNKLLALGADRRVLKDNEMFHSEVPLHGLQGQTWRNVEYASGLEYEGSITDYQVQDGNLFGTNFVFNKFQA