Scaffold Ga0257199_1025615

Overview

Basic Information

• Taxon OID: 3300030567
• Scaffold ID: Ga0257199_1025615
• Source Dataset Name: Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2S (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 775
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces litmocidini (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 46.9233
  • Long. (^o): -110.8694

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078067	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257199_10256151	F078067	N/A	PQQSTIQHMAELLDKRRAVFVSASFLSKQYKSIPKEILDNSIFFFGAKRSWLFPTNREEMVEARSQPTKYLEFDEDFKSIILQKETSGLCCWLKQYNDFRKVSEFFEKIVDPVSGENYLPLVLDDNWWLNEFDLKDAKFASTVEQVISNYKAVEHDYDAVMELIYQSNPTLVPTLYWASEAEEKI