Scaffold Ga0257186_1051870

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257186_1051870

Scaffold Ga0257186_1051870

Overview

Basic Information
Taxon OID	3300030566 Open in IMG/M
Scaffold ID	Ga0257186_1051870 Open in IMG/M
Source Dataset Name	Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-1 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	737
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location
Location Name	USA: Montana
Coordinates	Lat. (^o)	45.755	Long. (^o)	-113.9106	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081942	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257186_10518701	F081942	GAG	MKFFRRFLLIPAGAAVFLIEIFYIMGGVLWLVGWPYGQRLQSDNNYNGLWDADGPARFYYILVTVLGLVNMFFLPLVLIPFWKGYIARWIATALIPITLWILAILTNVLYATVRFIPLNCGDLSDTVNGTGDYVKYCKGGKIIFSGTLVLMFTVGICCGFLIWLLQEALFQAIRKVHKRGKSRDAKLETRRGPADTVTGGV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.