NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311357_10612137

Scaffold Ga0311357_10612137


Overview

Basic Information
Taxon OID3300030524 Open in IMG/M
Scaffold IDGa0311357_10612137 Open in IMG/M
Source Dataset NameII_Palsa_N3 coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1000
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008431Metagenome / Metatranscriptome333Y
F037974Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0311357_106121371F037974AGGAGMSNMNHATDILRVKQIAIDEDGNVTKRFPRIDAEGQLKNTLLFAIHPEICVLSMQVPGGLLDAY
Ga0311357_106121373F008431N/AARGAATRRRRDQQESSKTNGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLYRVTEFQTRADIGRSGEPILRKETLKKNNPAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.