Scaffold Ga0268242_1058428

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268242_1058428

Scaffold Ga0268242_1058428

Overview

Basic Information
Taxon OID	3300030513 Open in IMG/M
Scaffold ID	Ga0268242_1058428 Open in IMG/M
Source Dataset Name	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	740
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Mexico: San Luis Potosi
Coordinates	Lat. (^o)	21.766	Long. (^o)	-100.163	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060605	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268242_10584282	F060605	AGGTGG	MVDIDGALKVEIEVKNYEQVVKNDKGRFFGAATKVPGVNSFIQSKVDQTIEQEVKKNLEQTLPKKLADELTKGLQQEGVQASVSVSLTY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.