NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268259_10077508

Scaffold Ga0268259_10077508


Overview

Basic Information
Taxon OID3300030499 Open in IMG/M
Scaffold IDGa0268259_10077508 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)716
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.0936Long. (o)-100.2988Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005860Metagenome / Metatranscriptome388Y

Sequences

Protein IDFamilyRBSSequence
Ga0268259_100775081F005860GAGGMSIQPPPPSAEQLASWRALIKRIRQGDRSQVLAWDEGTAAKSQGTYQVLVTQQLHRRLRGAPPLLAGSVAGIVAVLRVDPTEASMIFRRRGLGDSGWTVTFGAAQGMLTYWVLQPEPIVVLLDLTWAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.