Scaffold Ga0268259_10020280

Overview

Basic Information

• Taxon OID: 3300030499
• Scaffold ID: Ga0268259_10020280
• Source Dataset Name: Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1224
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Guanajuato, Mexico
• Coordinates
  • Lat. (^o): 21.0936
  • Long. (^o): -100.2988

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029039	Metagenome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268259_100202801	F029039	N/A	HSDPEVGVVDGYAVLPLAVQRGQQPIDLAGGQADPCARPPTHRFTSSERAAIHAAFHGRTVSFVQDPAAALRQRPPGSLLLVATQPLLAGRRGTVMVLSCVPDPQQVLVTVQWDGHAWRATATGAGKR