Scaffold Ga0268240_10032795

Overview

Basic Information

• Taxon OID: 3300030496
• Scaffold ID: Ga0268240_10032795
• Source Dataset Name: Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1050
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Penjamo
• Coordinates
  • Lat. (^o): 20.686
  • Long. (^o): -101.875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004391	Metagenome / Metatranscriptome	440	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268240_100327953	F004391	GGAG	LLYTDATVLWRFALLRAGWWRTKQRARIPTRPLSHNQIKREESLKRHAWVRYRSWSRITSGVLLSVIGAVQYGTSKVFYKIVPHFDAQALRQYLHQIMATFSKTGQDVVM