Scaffold Ga0268240_10012621

Overview

Basic Information

• Taxon OID: 3300030496
• Scaffold ID: Ga0268240_10012621
• Source Dataset Name: Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1474
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Penjamo
• Coordinates
  • Lat. (^o): 20.686
  • Long. (^o): -101.875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072063	Metagenome / Metatranscriptome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0268240_100126211	F072063	GAGG	MVDDIVEALSARFGPGWAENTDANIRFAIEAERLLGDLDDAHMIGEPELDEHRVTIQFWVDRPITDLMTADRIAFEIFARISIEVFYSERQFVEGAIVYAFVTGTSRYGHSGSVVLAGPYAAEFSERFRQRLVGGPRYHA