Scaffold Ga0310037_10164413

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310037_10164413

Scaffold Ga0310037_10164413

Overview

Basic Information
Taxon OID	3300030494 Open in IMG/M
Scaffold ID	Ga0310037_10164413 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1000
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location Name	Germany: Weissenstadt
Coordinates	Lat. (^o)	50.1318	Long. (^o)	11.881	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026957	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310037_101644131	F026957	N/A	ATAVRRWHRVNEDIIQAALAALPYRDRAALRDAAPALRDLTASIDAQAD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.