Scaffold Ga0311338_10046966

Overview

Basic Information

• Taxon OID: 3300030007
• Scaffold ID: Ga0311338_10046966
• Source Dataset Name: I_Palsa_E1 coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5798
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3535
  • Long. (^o): 19.0473
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053727	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311338_100469662	F053727	GGAGG	MAPHASSAVPLSLETGPEQLPAGPRLTREEPPAAAQRDRPRPLEVAQCSMCGTALPLGLLVADGGQACASIRWYCKDAKSCTERWTTAR