Scaffold Ga0311339_10847404

Overview

Basic Information

• Taxon OID: 3300029999
• Scaffold ID: Ga0311339_10847404
• Source Dataset Name: I_Palsa_E3 coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 874
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3535
  • Long. (^o): 19.0473
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012158	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311339_108474041	F012158	GGAGG	MAVQGERIGGGFILITGLDGIRYAVRPQSVGIIHDTDECHDETMIQLYGGHVVRVPCPLDEVLVWFA