Scaffold Ga0311336_10759469

Overview

Basic Information

• Taxon OID: 3300029990
• Scaffold ID: Ga0311336_10759469
• Source Dataset Name: I_Fen_N2 coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 834
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0469
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080409	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311336_107594692	F080409	GGCGG	MEARALVRPLFAVICLGATALGLNNTYGDDTESKALAEKVACGTATCSVKLLHEGRSAFKQSFGFQTALVQKGKVPRGASVDVACQRQYILLGEYRCAIVSGGLPEASP