Scaffold Ga0272449_1143243

Overview

Basic Information

• Taxon OID: 3300029977
• Scaffold ID: Ga0272449_1143243
• Source Dataset Name: Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 777
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5734
  • Long. (^o): -110.795

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074155	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272449_11432431	F074155	GAGG	VAANLLSFDFIRGRLSPEQLEEFAVSLGVCLECGGNLVSKDGEIVCISCGLVWAVENTADYVPFPEYESVDGGEGNHFEGHWQPCNTLAFLKGLGDPALANGRGKALMRVLAKSPNGAEDLGLRARQVKTLVEWEDPPQLRRVLSRISLLLTRMGQRDNWLLADYAGNLARKIVAFKLLTKQPISYKLGDAITAHTIEKFGLKTAASDLKVENEDLQLIQ