Scaffold Ga0311346_10032345

Overview

Basic Information

• Taxon OID: 3300029952
• Scaffold ID: Ga0311346_10032345
• Source Dataset Name: II_Bog_N3 coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7986
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0477
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094780	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311346_100323457	F094780	N/A	MSPPTRTPLRPHTLILGAIIVACVAAIVWMISYAVPLKLAGQAYMMIAILLAFRYWPPMFRWVAAMPAVHRLVFALLIGGMICGHYTLNGRTYFPFVVWEIFPFVHEVDPVTCREFIATTESGTKVRLLTEQLFPSIVQVDPLDALDNPGAYPPGTTESLARALAKVYNELHPRDPVRQIDLFNMAVKLHPPSGESRQPSCELLKHYDVSSDQ