Basic Information | |
---|---|
Taxon OID | 3300029948 Open in IMG/M |
Scaffold ID | Ga0119873_1052397 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from Shatin wastewater treatment plant, Hong Kong - ST_Foam_2012.3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hong Kong |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 535 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shatin Wastewater Treatment Plant, Hong Kong |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011936 | Metagenome / Metatranscriptome | 285 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119873_10523972 | F011936 | AGGGGG | LDELSITGRMQRLESDHNMLVRDYSRLNDAIVKISESLTQLVVIQEQNKAIMACIERQQMSIDKLDARLDVLEVQQPQLLELRSWVLTWLGLIISAVLVAIIALVLK |
⦗Top⦘ |