Scaffold Ga0119873_1033559

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119873_1033559

Scaffold Ga0119873_1033559

Overview

Basic Information
Taxon OID	3300029948 Open in IMG/M
Scaffold ID	Ga0119873_1033559 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Shatin wastewater treatment plant, Hong Kong - ST_Foam_2012.3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	692
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shatin Wastewater Treatment Plant, Hong Kong

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091594	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119873_10335592	F091594	GAGG	MSENGITHYCLGNGELKCDGCQQEKNWQTLNQMPDTLRKSLQAQAQRIDDTDCILSGRPWYVGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.