Scaffold Ga0119933_1000014

Overview

Basic Information

• Taxon OID: 3300029932
• Scaffold ID: Ga0119933_1000014
• Source Dataset Name: Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 27975
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016639	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119933_100001414	F016639	N/A	SLLAQGNTGSEILSILDALVADNVSGFDYIESPQLESALGVPTLEEVSF