Scaffold Ga0119944_1000168

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119944_1000168

Scaffold Ga0119944_1000168

Overview

Basic Information
Taxon OID	3300029930 Open in IMG/M
Scaffold ID	Ga0119944_1000168 Open in IMG/M
Source Dataset Name	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11081
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (52.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment Plant In Pearl River Delta Area, China

Source Dataset Sampling Location
Location Name	China: Pearl River Delta area
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030347	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119944_100016822	F030347	GGA	MNYRKHKQAENARKPKKEKYNPYVNDPSDAKCPYCGESGKICSYINSVSRGWGRGACAKKHNNVKINES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.