Scaffold Ga0247050_1000114

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247050_1000114

Scaffold Ga0247050_1000114

Overview

Basic Information
Taxon OID	3300029912 Open in IMG/M
Scaffold ID	Ga0247050_1000114 Open in IMG/M
Source Dataset Name	Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-A3a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DMAC, Technical University of Denmark
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	23039
Total Scaffold Genes	28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (64.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location Name	Greenland: Kangerlussuaq
Coordinates	Lat. (^o)	67.09	Long. (^o)	-50.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058359	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247050_10001141	F058359	GAG	MISASECFHSATLELVRSTPIKQRLICAYRKHLANLTAEQVPT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.