Scaffold Ga0247051_1019607

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247051_1019607

Scaffold Ga0247051_1019607

Overview

Basic Information
Taxon OID	3300029901 Open in IMG/M
Scaffold ID	Ga0247051_1019607 Open in IMG/M
Source Dataset Name	Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DMAC, Technical University of Denmark
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2772
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location Name	Greenland: Kangerlussuaq
Coordinates	Lat. (^o)	67.09	Long. (^o)	-50.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050030	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247051_10196075	F050030	AGGAG	MPKPSDDDPLAAFELPPDLMSSTFEHAISDHADLTHEQGHAVAAALQRLLAGSTVEYGFPGMVTARLKSGALAHCGGPSIGWMIDVQRKPGGSPVTVDVNVPSDETDPVRLAELLAKALRKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.