Scaffold Ga0247047_1006031

Overview

Basic Information

• Taxon OID: 3300029899
• Scaffold ID: Ga0247047_1006031
• Source Dataset Name: Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_U-A2a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DMAC, Technical University of Denmark
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5157
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location

• Location Name: Greenland: Tasiilaq
• Coordinates
  • Lat. (^o): 65.41
  • Long. (^o): -38.51

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012906	Metagenome / Metatranscriptome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247047_10060312	F012906	GGA	MNIEIHKPDLAHRVRAQMQSDHFKDADELIEKALDALDEQASLTVPEAATGAVVLAALQASPYRDIDLTPPRVRLANARDVVL