Scaffold Ga0247036_1013953

Overview

Basic Information

• Taxon OID: 3300029897
• Scaffold ID: Ga0247036_1013953
• Source Dataset Name: Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-B2b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DMAC, Technical University of Denmark
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2608
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location

• Location Name: Greenland: Tasiilaq
• Coordinates
  • Lat. (^o): 65.38
  • Long. (^o): -38.53

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092800	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247036_10139531	F092800	N/A	MEPINKQLPELELWLQDAQAYVFKMTGGSMKKAGFHFDRNHFTFTRKNKKSLDQLAIIFVSHFPVNFRISFQLDIWHPQIKQIKESFLGDILNKDSNLASIILQMKDFTSQDSEQQPVKDYSICDHRDLFMACDWLAHTLQYELIPICDQMSSIAHLDDFFESKPDWTLNSHSGGNICTDLIVARLNGKRDVHQRYRQLFE