Basic Information | |
---|---|
Taxon OID | 3300029896 Open in IMG/M |
Scaffold ID | Ga0247044_1057414 Open in IMG/M |
Source Dataset Name | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DMAC, Technical University of Denmark |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 779 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greenland: Tasiilaq | |||||||
Coordinates | Lat. (o) | 65.38 | Long. (o) | -38.53 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046787 | Metagenome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247044_10574143 | F046787 | N/A | MSESDKPLRQQIDEGMEAIRHQLERLREGPTLGEPSDDRTLIADLEAEYQALKEARGSVGAHDRAPDEFDCDTRD |
⦗Top⦘ |