NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0246100_133406

Scaffold Ga0246100_133406


Overview

Basic Information
Taxon OID3300029891 Open in IMG/M
Scaffold IDGa0246100_133406 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2158
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Berkeley
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)769
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Source Dataset Sampling Location
Location NameJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)Depth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083668Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0246100_1334063F083668AGGAGMKKWSPDKITAVILIVGCFGLLFTGIDGEVKAILTIAAGYLFGTSIIERKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.