Scaffold Ga0246001_1021289

Overview

Basic Information

• Taxon OID: 3300029889
• Scaffold ID: Ga0246001_1021289
• Source Dataset Name: Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1879
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat → Peat Microbial Communities From Marcell Experimental Forest Bog In Minnesota, Usa

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.506
  • Long. (^o): -93.454
  • Depth (m): .3 to .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048470	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0246001_10212892	F048470	GGAGG	MAKRERFVTPVTCPQCALNGSATWEESERGNLETTLKGVSDGFKIDGGQEIYCASCGVKAIVGRTVSRSEMK