Scaffold Ga0134854_1069506

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134854_1069506

Scaffold Ga0134854_1069506

Overview

Basic Information
Taxon OID	3300029822 Open in IMG/M
Scaffold ID	Ga0134854_1069506 Open in IMG/M
Source Dataset Name	Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chongqing University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	684
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location Name	China: Chengdu
Coordinates	Lat. (^o)	30.65	Long. (^o)	104.06	Alt. (m)		Depth (m)	.01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048180	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134854_10695061	F048180	AGGAGG	MKMLTVKGGFRHEGVKFDNEREMPFPETLEELIEEYPEEVIVRKFNAELRRNYAQQLRDEKALELGIQTISKADQAQIDFLSGILNSLGYDTEDLRTLADYQEALKEVTQG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.