Scaffold Ga0134854_1040111

Overview

Basic Information

• Taxon OID: 3300029822
• Scaffold ID: Ga0134854_1040111
• Source Dataset Name: Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chongqing University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1147
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location

• Location Name: China: Chengdu
• Coordinates
  • Lat. (^o): 30.65
  • Long. (^o): 104.06
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028664	Metagenome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134854_10401111	F028664	N/A	MKEIQKILVGGQALRNLGSDRHTEDVDFLVNDKNTTDAFINTVGVDYINANGNKFFNEIYNIEKGNEQATPQSLFELKVYAFVQHCQNFNFAKADSCEYDLKFLVRNFNITESKIARKYITSGEYSEVVKIIKSVKF