Scaffold Ga0246092_1003129

Overview

Basic Information

• Taxon OID: 3300029821
• Scaffold ID: Ga0246092_1003129
• Source Dataset Name: Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Berkeley
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11100
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Source Dataset Sampling Location

• Location Name: Japan: Horonobe URL
• Coordinates
  • Lat. (^o): 45.045278
  • Long. (^o): 141.859444
  • Depth (m): 215

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091055	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0246092_10031292	F091055	AGGAG	MIKVVFQYHVTKEKQAEYLQLTQDKIKPFWEANGCQSYTVWQVAESDTGFIKEMLFESGSALKETMALKQANPIKELYFKFATDISRKIVTKKI