Basic Information | |
---|---|
Taxon OID | 3300029799 Open in IMG/M |
Scaffold ID | Ga0311022_13643072 Open in IMG/M |
Source Dataset Name | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 634 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Toronto, Ontario, canada | |||||||
Coordinates | Lat. (o) | 43.5479 | Long. (o) | -79.6609 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027437 | Metagenome / Metatranscriptome | 194 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0311022_136430722 | F027437 | N/A | MTRQISTLEEKHSRDQAELVQRCSDFEEKYSQSQIELAQVSAALDDANALSSSLHAQLNSEKVTYETVPCLVVLLLLA |
⦗Top⦘ |