Scaffold Ga0239581_1041451

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0239581_1041451

Scaffold Ga0239581_1041451

Overview

Basic Information
Taxon OID	3300029798 Open in IMG/M
Scaffold ID	Ga0239581_1041451 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Uppsala University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1078
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland

Source Dataset Sampling Location
Location Name	Finland: Alinen Mustajarvi in Hameenlinna
Coordinates	Lat. (^o)	61.208142	Long. (^o)	25.113609	Alt. (m)		Depth (m)	5.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040431	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0239581_10414511	F040431	N/A	VAVSTLYAWRRKAATGRPASRVAFVAVPNLLSEVPAAPAYRLHWRSGLSLEVRTGFSAQELATLLQLLPVL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.