NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0245271_123307

Scaffold Ga0245271_123307


Overview

Basic Information
Taxon OID3300029706 Open in IMG/M
Scaffold IDGa0245271_123307 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35564
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1138
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Source Dataset Sampling Location
Location NameUnited Kingdom: London
CoordinatesLat. (o)51.5Long. (o)-0.12Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068811Metagenome124N

Sequences

Protein IDFamilyRBSSequence
Ga0245271_1233072F068811AGGAMDQDGSEHNICSNREGLCPGKEQHGASGWKKIFQHGKEPLRNKDSVSQYCNKKAAVLLILNENVSETLCIFSIDKTNCCRI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.