Scaffold Ga0135266_101697

Overview

Basic Information

• Taxon OID: 3300029632
• Scaffold ID: Ga0135266_101697
• Source Dataset Name: Marine harbor viral communities from the Pacific Ocean - SMB3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Michigan State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1127
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 34.536667
  • Long. (^o): 122.141667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058820	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135266_1016971	F058820	N/A	MHFCFPVTIGGHTMDELTQVEYSEWLRWCGAVDAELYTNPLDNDPDYLAGFAERYAELECEGHKNA