Scaffold Ga0238865_10399

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0238865_10399

Scaffold Ga0238865_10399

Overview

Basic Information
Taxon OID	3300029631 Open in IMG/M
Scaffold ID	Ga0238865_10399 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Ross Sea, Antarctic Ocean - 124LC-38360620
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute for Systems Biology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4025
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Seawater Microbial Communities From Ross Sea, Antarctic Ocean

Source Dataset Sampling Location
Location Name	Southern Ocean: Ross Sea
Coordinates	Lat. (^o)	-76.4986	Long. (^o)	-179.9884	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003761	Metagenome / Metatranscriptome	470	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0238865_103994	F003761	AGGA	MAALVELATTDLWGHEPCWYVSEMNRPARDSKSVRRYQTITVIRNDRRVKLERDIGDARLFGEEFQLICGVPDGKGGGEAMYTVDEAIRMAQDMNLTPPPKTEVKPRDWKKIFWDNVEERNKWKKGQSIFGPNYKKERT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.