NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243128_1023791

Scaffold Ga0243128_1023791


Overview

Basic Information
Taxon OID3300029449 Open in IMG/M
Scaffold IDGa0243128_1023791 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellow Sea, Weihai, China - HGD.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShandong University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2104
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China

Source Dataset Sampling Location
Location NameChina: Weihai
CoordinatesLat. (o)37.31Long. (o)122.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039153Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0243128_10237913F039153N/AMKYTVITPAATKQYNTAVLFLNNSHGARRLNFSPFHKEVKQWAKHQGYSAKLYLRSAAIECNNPDLPKESKLFVVDLIQIIANGQAYLVAIDTLGPSENNLHFILEEHAKLRKAIYVTAECLDDVICEIQDNEYNHKGVPCVPDIKSRRSFQGDYSILFSPENLTWKTARNERA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.