Scaffold Ga0183755_1010518

Overview

Basic Information

• Taxon OID: 3300029448
• Scaffold ID: Ga0183755_1010518
• Source Dataset Name: Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3664
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Mediterranean Sea: TARA_023
• Coordinates
  • Lat. (^o): 42.1735
  • Long. (^o): 17.7252
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022311	Metagenome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183755_10105183	F022311	GAGG	MPRSIIDPSYDPIYDQIRGILGEHFDNYCFVVMGENGDIFYDYNHLPAGRMLLYEAQKEILAQNIEIEWIEEEPEEPEDPGKND