NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183755_1000596

Scaffold Ga0183755_1000596


Overview

Basic Information
Taxon OID3300029448 Open in IMG/M
Scaffold IDGa0183755_1000596 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21526
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (96.15%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameMediterranean Sea: TARA_023
CoordinatesLat. (o)42.1735Long. (o)17.7252Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001655Metagenome / Metatranscriptome656Y
F002858Metagenome / Metatranscriptome525Y
F071124Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0183755_100059618F001655GGAGGMKQPENSHTKHFGNDGPISNDAEIIVYYEQHGPAEPVLRIPFWYYKEELGMFEHFEASVHRTAKALKESYTYWPEGYVHVQTLINDEYVNMV
Ga0183755_100059619F002858AGGAGMAIDEKSIYVVDGGDYSIYCLGYTQARAVTNDIMRADPWGGIPFVLRKDLELSLDDRGNVVMSKSTLDKILFLASDELPEGDA
Ga0183755_100059621F071124AGGMTYAEYELGYYMGDSEDYSGPPEDPETQAMLEHLVEFETEMYRLNCKRRLSGCTYKQLKGLLINLHGEDWKDAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.