Scaffold Ga0183755_1000216

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183755_1000216

Scaffold Ga0183755_1000216

Overview

Basic Information
Taxon OID	3300029448 Open in IMG/M
Scaffold ID	Ga0183755_1000216 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	32953
Total Scaffold Genes	65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	46 (70.77%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Mediterranean Sea: TARA_023
Coordinates	Lat. (^o)	42.1735	Long. (^o)	17.7252	Alt. (m)		Depth (m)	55
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019133	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183755_100021618	F019133	N/A	MIDEDRTYENEVRYNNDRLGVKKNRSNYKSNIPLDLASSDTQEIQKEKINGICFNNDFM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.