Scaffold Ga0167332_1023203

Overview

Basic Information

• Taxon OID: 3300029446
• Scaffold ID: Ga0167332_1023203
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1622
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.355554
  • Long. (^o): 18.227079

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078675	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0167332_10232031	F078675	AGGAG	MPDNFGRMTSDEAPQHTPGPWTIYNHAGTNSGHYDGYLKSDIRAGADLIHIRQSVAGNTFPRLAANVRLIAAAPSMYDALWAIANMQVQEETDKGEVLALCMSIARIELEKCSTK