Basic Information | |
---|---|
Taxon OID | 3300029365 Open in IMG/M |
Scaffold ID | Ga0243866_1001100 Open in IMG/M |
Source Dataset Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 064_3_10_stool_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 35856 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 26 (96.30%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Baltimore | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099269 | Metagenome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243866_100110027 | F099269 | GAG | VGELLLLDDLGDRAGGASVLASATGDAGILVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV |
⦗Top⦘ |