NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243376_100500

Scaffold Ga0243376_100500


Overview

Basic Information
Taxon OID3300029322 Open in IMG/M
Scaffold IDGa0243376_100500 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-59_Run3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterZhejiang University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16245
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location
Location NameChina: Hangzhou
CoordinatesLat. (o)30.0Long. (o)120.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047125Metagenome / Metatranscriptome150N

Sequences

Protein IDFamilyRBSSequence
Ga0243376_1005003F047125AGGAMDVVLLLIVLGVMLSGFWAADALDHIRKEIIRQEGKRRGWWS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.