Scaffold Ga0185543_1012881

Overview

Basic Information

• Taxon OID: 3300029318
• Scaffold ID: Ga0185543_1012881
• Source Dataset Name: Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2041
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_038
• Coordinates
  • Lat. (^o): 19.0393
  • Long. (^o): 64.4913
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035329	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0185543_10128816	F035329	GGA	MATKKSLILNAGLFQELNTSADKLDLAGNSTSDLSEGTNQYFTN