Scaffold Ga0135226_1036226

Overview

Basic Information

• Taxon OID: 3300029308
• Scaffold ID: Ga0135226_1036226
• Source Dataset Name: Marine harbor viral communities from the Indian Ocean - SRB2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Michigan State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location

• Location Name: Indian Ocean
• Coordinates
  • Lat. (^o): 3.715
  • Long. (^o): 105.408333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021321	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135226_10362262	F021321	N/A	MANMLFNINDVVETIQGHSINNDIIEEYDESQFEEEPITLMDIPKDWEGSSISIGDCLLDLQTHINELYNYFSSQEEV