Basic Information | |
---|---|
Taxon OID | 3300029288 Open in IMG/M |
Scaffold ID | Ga0265297_10003460 Open in IMG/M |
Source Dataset Name | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28478 |
Total Scaffold Genes | 42 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 38 (90.48%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Waterloo, Ontario | |||||||
Coordinates | Lat. (o) | 43.442 | Long. (o) | -80.577 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018007 | Metagenome / Metatranscriptome | 237 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265297_100034604 | F018007 | GGA | MDTVMFNGWKITNIFDVVPCELNTADGPYNKTGYRLERREDGFAITVGMMEHISGWSAWEVLGWLNDKQAIPRRYDNARSRI |
⦗Top⦘ |