NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168097_1033267

Scaffold Ga0168097_1033267


Overview

Basic Information
Taxon OID3300029255 Open in IMG/M
Scaffold IDGa0168097_1033267 Open in IMG/M
Source Dataset NameBiosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1186
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.844519Long. (o)17.659844Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061870Metagenome / Metatranscriptome131N
F074914Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0168097_10332671F061870GGAGGMKRRIQKLESLTSWKSLPDASEYIQVWAIDPDQDEAEKWFETRDGARVTDPKTIERLTAYYSEAVRRGTVNVTARFDDYDDPEDTTGTGA
Ga0168097_10332672F074914AGGGGGMKISTLLRKANAALCKIESLNPEEIDREVFKMEIEKARAIAYLVRTVSEIISKNEMEDRIAALENAILQEKAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.