Scaffold Ga0168097_1009559

Overview

Basic Information

• Taxon OID: 3300029255
• Scaffold ID: Ga0168097_1009559
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3066
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.844519
  • Long. (^o): 17.659844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077339	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168097_10095595	F077339	N/A	MNTTLEIPEGSKATIQGKVIDGKNYLVVEVEQEPEWTKFKRGDVLICPDAEKEIFVIFDEYRNGHSRHYFNCLFNSVYDGDTCWVSELFRKATDAERARFIKWLDEEKGLEWDGEKLVEILKEGDMCIFWDYTSCEAIIAVYRGGIPGNYVDHLAMYWENAIKWDGTREQYEKVLRGELKXXXXMNNPNSTSLFIGMGKGRTLNK